Skip to product information
1 of 1

GeneBio Systems

Recombinant Mesocricetus auratus Multifunctional fusion protein (Il1b)

Recombinant Mesocricetus auratus Multifunctional fusion protein (Il1b)

SKU:A0A1U7Q9G0

Regular price $982.60 CAD
Regular price Sale price $982.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: A0A1U7Q9G0

Gene Names: Il1b

Alternative Name(s): (IL1B)

Abbreviation: Recombinant Mesocricetus auratus Il1b protein

Organism: Mesocricetus auratus (Golden hamster)

Source: E.coli

Expression Region: 1-267aa

Protein Length: Full Length

Tag Info: N-terminal 6xHis-tagged and C-terminal Strep II-tagged

Target Protein Sequence: MATVPELDSEMIAFHSDENDLFFEVDGLQKMKSCFQSLDLSYPDESIQLQISKQDLNKSFRQVVSVIVAVEKLWNTPVPCPWTFQDEDLRTFFSFIFEEEPIFCDSWDGELIVADAPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNINQQVVFSMSFVQGETSNNKIPVALGLKGKNLYLSCVMKGDTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHKPVFLGNNSGQDLVDFTMESVSS

MW: 32.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Potent pro-inflammatory cytokine. Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and cytokine production, B-cell activation and antibody production, and fibroblast proliferation and collagen production. Promotes Th17 differentiation of T-cells. Synergizes with IL12/interleukin-12 to induce IFNG synthesis from T-helper 1 (Th1) cells. Plays a role in angiogenesis by inducing VEGF production synergistically with TNF and IL6. Involved in transduction of inflammation downstream of pyroptosis: its mature form is specifically released in the extracellular milieu by passing through the gasdermin-D (GSDMD) pore.

Reference: 1 RefSeq Submitted (APR-2022) to UniProtKB Cited for: IDENTIFICATION.

Function:

View full details