Skip to product information
1 of 1

GeneBio Systems

Recombinant Mesobuthus martensii Beta-insect depressant toxin BmKITa, partial

Recombinant Mesobuthus martensii Beta-insect depressant toxin BmKITa, partial

SKU:Q9XY87

Regular price $1,239.30 CAD
Regular price Sale price $1,239.30 CAD
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: Q9XY87

Gene Names: N/A

Alternative Name(s): (BmK ITa)(BmK dITAP3)

Abbreviation: Recombinant Mesobuthus martensii Beta-insect depressant toxin BmKITa protein, partial

Organism: Mesobuthus martensii (Manchurian scorpion) (Buthus martensii)

Source: E.coli

Expression Region: 22-82aa

Protein Length: Partial

Tag Info: N-terminal 10xHis-tagged

Target Protein Sequence: DGYIRGSNGCKVSCLWGNEGCNKECRAYGASYGYCWTWGLACWCQGLPDDKTWKSESNTCG

MW: 12.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Depressant insect beta-toxins cause a transient contraction paralysis followed by a slow flaccid paralysis. They bind voltage-independently at site-4 of sodium channels (Nav) and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing. This toxin also displays an evident analgesic effect but is devoid of any toxicity on mice.

Reference: "Purification of two depressant insect neurotoxins and their gene cloning from the scorpion Buthus martensi Karsch." Wang C.-G., Ling M.-H., Chi C.-W., Wang D.-C., Pelhate M. J. Pept. Res. 61: 7-16(2003)

Function:

View full details