Gene Bio Systems
Recombinant Meriones unguiculatus Beta-3 adrenergic receptor(ADRB3)
Recombinant Meriones unguiculatus Beta-3 adrenergic receptor(ADRB3)
SKU:CSB-CF001393MRA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Meriones unguiculatus (Mongolian jird) (Mongolian gerbil)
Uniprot NO.:O70432
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:RVGADAEAQECHSNPRCCSFASNMPYALLSSSVSFYLPLLVMLFVYARVFVVAKRQRRLL RRELGRFPPEESPRSPSRSPSPVAGGTGEAPDGVPSCGRRPARLLPLREHRALRTLGLIM GIFSLCWLPFFLANVLRALAGPSIVPNGVFIALNWLGYANSAFNPLI
Protein Names:Recommended name: Beta-3 adrenergic receptor Alternative name(s): Beta-3 adrenoreceptor Short name= Beta-3 adrenoceptor
Gene Names:Name:ADRB3
Expression Region:1-167
Sequence Info:full length protein
