Skip to product information
1 of 1

Gene Bio Systems

Recombinant Medicago truncatula CASP-like protein N24(N24)

Recombinant Medicago truncatula CASP-like protein N24(N24)

SKU:CSB-CF521293MQP

Regular price $2,214.80 CAD
Regular price Sale price $2,214.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Medicago truncatula (Barrel medic) (Medicago tribuloides)

Uniprot NO.:O24088

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSTINIESLDQDTKDEPKEQTQEDNNEVLKVLEEKINMMDPKNTSGDTEVVITNFLKSKK EVKWYVALLVIRVFAFVFCLIAFSVLGASEQRVLVSENLTNWYSSGFTIQTPYEFHWYKW DEFRYSFAANVIGFVYSGLQICHLVMYLITKKHTINPKLQGYFNVAIDQTLAYILMSASS SAATAAHLLKDYWLEHGADTFIEMANASVSMSFLAFGAFALASLVSGIILCRFT

Protein Names:Recommended name: CASP-like protein N24 Alternative name(s): Nodulin 24 Short name= MtN24

Gene Names:Name:N24

Expression Region:1-234

Sequence Info:full length protein

View full details