Gene Bio Systems
Recombinant Mastigocladus laminosus Photosystem I reaction center subunit XI(psaL)
Recombinant Mastigocladus laminosus Photosystem I reaction center subunit XI(psaL)
SKU:CSB-CF519958MQJ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Mastigocladus laminosus (Fischerella sp.)
Uniprot NO.:O31126
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAQAIDASKNSPSDPRNREVVFPAYRDPQIGDLETPINSSPLVKWFIGNLPAYRPGITTF RRGLEVGMAHGYWIFGPFAKLGPLRNTVNANLAGLLSALGLIIILTGALTLYANSKPPKP VKSVATPNPPEAFQSSEGWNNFASAFLIGGIGGAVVAYFLTSNLELIQSLFGG
Protein Names:Recommended name: Photosystem I reaction center subunit XI Alternative name(s): PSI subunit V PSI-L
Gene Names:Name:psaL
Expression Region:1-173
Sequence Info:full length protein
