Gene Bio Systems
Recombinant Marinomonas sp. Probable intracellular septation protein A (Mmwyl1_3397)
Recombinant Marinomonas sp. Probable intracellular septation protein A (Mmwyl1_3397)
SKU:CSB-CF409579MNJ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Marinomonas sp. (strain MWYL1)
Uniprot NO.:A6W0S1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKILFDFLPIVIFFVVYKMTGNIIIATAILIPATIIQVGFTWFKNRTIEKMHLVSLALVV LLGGATVLLGDGDFIKWKPTIVNGLFAIAFLGSQFIGDKNIIQRMMGDKLDLPFKVWRTL NLAWVGFFIVSGVTNLYVAFSYSEEIWVDFKLFGLLGMTIVFIILQGIYLSSHLQNKE
Protein Names:Recommended name: Probable intracellular septation protein A
Gene Names:Ordered Locus Names:Mmwyl1_3397
Expression Region:1-178
Sequence Info:full length protein
