Skip to product information
1 of 1

Gene Bio Systems

Recombinant Marchantia polymorpha Putative ATP synthase protein YMF19-like protein(YMF18)

Recombinant Marchantia polymorpha Putative ATP synthase protein YMF19-like protein(YMF18)

SKU:CSB-CF327838MCB

Regular price $2,098.60 CAD
Regular price Sale price $2,098.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Marchantia polymorpha (Liverwort) (Marchantia aquatica)

Uniprot NO.:P38461

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLCRTNVLHLRPQLNKFTYLTQFLWLCLFYITFYFVLYSVLVFTNTEWPFILLKKRLVSQ EKIRAYQSNDCVGQTRGLTSEPSWRDACWRALILAYLTSIYFFPILGSFPRVLKDQVDFG YIPTVCILLYVIFLFFFDSYRKSLFTTALTHSFWL

Protein Names:Recommended name: Putative ATP synthase protein YMF19-like protein Alternative name(s): ORF 155

Gene Names:Name:YMF18

Expression Region:1-155

Sequence Info:full length protein

View full details