Gene Bio Systems
Recombinant Mannheimia succiniciproducens UPF0299 membrane protein MS1271(MS1271)
Recombinant Mannheimia succiniciproducens UPF0299 membrane protein MS1271(MS1271)
SKU:CSB-CF727551MAAB
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Mannheimia succiniciproducens (strain MBEL55E)
Uniprot NO.:Q65T32
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MRQKIFLFVRSLIILYLILFIGEGIAKLIPIGIPGSIFGLLILFIGLTTQIIKVDWVFFG ASLLIRYMAVLFVPVSVGVMKYSDLLVSHASSLLIPNIVSTCVTLLVIGFLGDYLFSLNS FTRLRKKAIKKRDINNVNNKGEAS
Protein Names:Recommended name: UPF0299 membrane protein MS1271
Gene Names:Ordered Locus Names:MS1271
Expression Region:1-144
Sequence Info:full length protein
