Gene Bio Systems
Recombinant Mannheimia succiniciproducens Probable intracellular septation protein A(MS0737)
Recombinant Mannheimia succiniciproducens Probable intracellular septation protein A(MS0737)
SKU:CSB-CF734345MAAB
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Mannheimia succiniciproducens (strain MBEL55E)
Uniprot NO.:Q65UL6
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKQLLEFIPLILFFVVYKLAGIREAAIALIIATIFQMLILKLKYGKIEKQQIIMGIAVVF FGTLTAYFNKVEYLQWKVTIVYALFALILLISQYGFKKPLIEKLLGKEIQLPEKIWNKLN LAWAGFFILCMLINIYISQYCSEEVWVDFKSFGIIAMTFIATLFTGIYVYRYLPKDDQNK
Protein Names:Recommended name: Probable intracellular septation protein A
Gene Names:Ordered Locus Names:MS0737
Expression Region:1-180
Sequence Info:full length protein
