Recombinant Malus domestica Major allergen Mal d 1(MALD1)

SKU: CSB-YP331771MPS

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Allergen

Uniprot ID: P43211

Gene Names: MALD1

Organism: Malus domestica (Apple) (Pyrus malus)

AA Sequence: GVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHYHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN

Expression Region: 2-159aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 19.5 kDa

Alternative Name(s): Allergen Mal d I Allergen: Mal d 1

Relevance:

Reference: "Cloning and sequencing of Mal d 1, the major allergen from apple (Malus domestica), and its immunological relationship to Bet v 1, the major birch pollen allergen."Vanek-Krebitz M., Hoffmann-Sommergruber K., Laimer da Camara Machado M., Susani M., Ebner C., Kraft D., Scheiner O., Breiteneder H.Biochem. Biophys. Res. Commun. 214:538-551(1995)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.