
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Allergen
Uniprot ID: P43211
Gene Names: MALD1
Organism: Malus domestica (Apple) (Pyrus malus)
AA Sequence: GVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHYHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN
Expression Region: 2-159aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 33.5 kDa
Alternative Name(s): Allergen Mal d I Allergen: Mal d 1
Relevance:
Reference: "Characterization of the 18-KDA apple allergen by two-dimensional immunoblotting and microsequencing."Vieths S., Schoening B., Petersen A.Int. Arch. Allergy Immunol. 104:399-404(1994)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.