Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) (Dandruff-associated fungus)
Uniprot NO.:A8PYF7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAGGPANWARAITGGSVVIGFGYLLLKTATPNEQQLYDSLSPDLKRRVDAQRSSQADSER SAKVKEEQSKRLV
Protein Names:Recommended name: Assembly factor CBP4 Alternative name(s): Cytochrome b mRNA processing protein 4
Gene Names:Name:CBP4 ORF Names:MGL_1653
Expression Region:1-73
Sequence Info:full length protein