Gene Bio Systems
Recombinant Macrocystis pyrifera Fucoxanthin-chlorophyll a-c binding protein C, chloroplastic(FCPC)
Recombinant Macrocystis pyrifera Fucoxanthin-chlorophyll a-c binding protein C, chloroplastic(FCPC)
SKU:CSB-CF675910MCAY
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Macrocystis pyrifera (Giant kelp)
Uniprot NO.:Q40299
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:SFESEIGAQAPLGFWDPLGLLEDADQDAFERLRYVEVKLGRIAMLAIAGHLTQQNARLPG MLSNSANLSFADMPNGVAALSKIPPGGLAQIFGFIGFLELAVMKNVEGSFPGDFTLGGNP FASSWDAMSAETQASKRAIELNNGRAAQMGILALMVHEELNNKPYVINDLLGASYNFN
Protein Names:Recommended name: Fucoxanthin-chlorophyll a-c binding protein C, chloroplastic
Gene Names:Name:FCPC
Expression Region:39-216
Sequence Info:full length protein
