Skip to product information
1 of 1

Gene Bio Systems

Recombinant Macrocystis pyrifera Fucoxanthin-chlorophyll a-c binding protein A, chloroplastic(FCPA)

Recombinant Macrocystis pyrifera Fucoxanthin-chlorophyll a-c binding protein A, chloroplastic(FCPA)

SKU:CSB-CF672546MCAY

Regular price $2,132.20 CAD
Regular price Sale price $2,132.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Macrocystis pyrifera (Giant kelp)

Uniprot NO.:Q40297

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SFESEIGAQAPLGFWDPLGLLADADQDGFERLRYVEVKHGRIAMLAIAGHLTQQNARLPG MLSNSANLSFADMPNGVAALSKIPPAGLAQIFAFIGFLELAVMKNVEGSFPGDFTLGGNP FGASWDAMSEETQASKRAIELNNGRAAQMGILALMVHEELNNKPYVINDLVGASYTFN

Protein Names:Recommended name: Fucoxanthin-chlorophyll a-c binding protein A, chloroplastic

Gene Names:Name:FCPA

Expression Region:40-217

Sequence Info:full length protein

View full details