Gene Bio Systems
Recombinant Macaca mulatta (Rhesus macaque) Interleukin-1 alpha(IL1A)
Recombinant Macaca mulatta (Rhesus macaque) Interleukin-1 alpha(IL1A)
SKU:CSB-EP011613MOW
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P48089
Gene Names: IL1A
Organism: Macaca mulatta (Rhesus macaque)
AA Sequence: SAPFSFLSNMTYHFIRIIKHEFILNDTLNQTIIRANDQHLTAAAIHNLDEAVKFDMGAYTSSKDDTKVPVILRISKTQLYVSAQDEDQPVLLKEMPEINKTITGSETNFLFFWETHGTKNYFISVAHPNLFIATKHDNWVCLAKGLPSITDFQILENQA
Expression Region: 113-271aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 34.1 kDa
Alternative Name(s): Hematopoietin-1
Relevance: Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
Reference: Comparative sequence analysis of cytokine genes from human and nonhuman primates.Villinger F.J., Brar S.S., Mayne A.E., Chikkala N., Ansari A.A.J. Immunol. 155:3946-3954(1995)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
