Gene Bio Systems
Recombinant Macaca mulatta (Rhesus macaque) Arachidonate 5-lipoxygenase-activating protein(ALOX5AP)
Recombinant Macaca mulatta (Rhesus macaque) Arachidonate 5-lipoxygenase-activating protein(ALOX5AP)
SKU:CSB-CF001625MOW
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Macaca mulatta (Rhesus macaque)
Uniprot NO.:P30354
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNC VDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLLVRQKYFVGYLGERTQSTPGYIFGKRIIL FLFLMSVAGIFNYYLIFFFGSDFENYIKTVTTT
Protein Names:Recommended name: Arachidonate 5-lipoxygenase-activating protein Alternative name(s): FLAP MK-886-binding protein
Gene Names:Name:ALOX5AP Synonyms:FLAP
Expression Region:1-153
Sequence Info:Full length protein
