Size: 20ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Immunology
Uniprot ID: P51496
Gene Names: IL10
Organism: Macaca mulatta (Rhesus macaque)
AA Sequence: SPGQGTQSENSCTRFPGNLPHMLRDLRDAFSRVKTFFQMKDQLDNILLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFSKLQEKGVYKAMSEFDIFINYIEAYMTMKIQN
Expression Region: 19-178aa
Sequence Info: Full Length of Mature Protein
Source: Baculovirus
Tag Info: N-terminal 10xHis-tagged and C-terminal myc-tagged
MW: 22.7 kDa
Alternative Name(s): Cytokine synthesis inhibitory factor
Relevance: Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells.
Reference: "Comparative sequence analysis of cytokine genes from human and nonhuman primates." Villinger F.J., Brar S.S., Mayne A.E., Chikkala N., Ansari A.A. J. Immunol. 155:3946-3954(1995)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.