
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: Q8HYP6
Gene Names: CCL20
Organism: Macaca mulatta (Rhesus macaque)
AA Sequence: ASNFDCCLRYTDRILHPKFIVGFTQQLANETCDINAVVFHTKKGLSVCANPKQTWVKLIVRRLSKKINKM
Expression Region: 27-96aa
Sequence Info: Full Length of Mature Protein
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 35.1 kDa
Alternative Name(s):
Relevance:
Reference: Molecular cloning and sequencing of 25 different rhesus macaque chemokine cDNAs reveals evolutionary conservation among C, CC, CXC, and CX3C families of chemokines.Basu S., Schaefer T.M., Ghosh M., Fuller C.L., Reinhart T.A.Cytokine 18:140-148(2002)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.