Gene Bio Systems
Recombinant Macaca mulatta C-X-C motif chemokine 10(CXCL10)
Recombinant Macaca mulatta C-X-C motif chemokine 10(CXCL10)
SKU:CSB-EP822646MOW
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: Q8MIZ1
Gene Names: CXCL10
Organism: Macaca mulatta (Rhesus macaque)
AA Sequence: IPLSRTVRCTCISISNQPVNPRSLEKLEIIPPSQFCPHVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
Expression Region: 22-98aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 12.7 kDa
Alternative Name(s): 10KDA interferon gamma-induced protein ;Gamma-IP10 ;IP-10Small-inducible cytokine B10
Relevance: Chotactic for monocytes and T-lymphocytes. Binds to CXCR3 .
Reference: Increased expression of the interferon-gamma-inducible chemokine Mig/CXCL9 in lymphoid tissues during simian immunodeficiency virus infection in vivo.Reinhart T.A., Fallert B.A., Pfeifer M., Capuano S. III, Rajakumar P., Murphey-Corb M., Day R., Fuller C.L., Schaefer T.
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.