>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20171228
Research areas: Others
Target / Protein: TTR
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Delivery time: 3-7 business days
Uniprot ID: Q8HXW1
AA Sequence: GPTGVDESKCPLMVKVLDAVRGSPAVNVAVNVFKKAADETWAPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKSLGISPFHEHAEVVFTANDSGPRHYTIAALLSPYSYSTTAVVTNPKE
Tag info: N-terminal 6xHis-tagged
Expression Region: 21-147aa
Protein length: Full Length
MW: 17.7 kDa
Alternative Name(s): Prealbumin
Relevance: Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain .
Reference: Isolation and characterization of cDNA for macaque neurological disease genes.Kusuda J., Osada N., Hida M., Sugano S., Hashimoto K. DNA sequences of macaque genes expressed in brain or testis and its evolutionary implications.International consortium for macaque cDNA sequencing and analysis
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.