Recombinant Macaca fascicularis Transthyretin(TTR)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Macaca fascicularis Transthyretin(TTR)

CSB-EP025270MOV
Regular price
$1,066.00 CAD
Sale price
$1,066.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171228

Research areas: Others

Target / Protein: TTR

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Delivery time: 3-7 business days

Uniprot ID: Q8HXW1

AA Sequence: GPTGVDESKCPLMVKVLDAVRGSPAVNVAVNVFKKAADETWAPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKSLGISPFHEHAEVVFTANDSGPRHYTIAALLSPYSYSTTAVVTNPKE

Tag info: N-terminal 6xHis-tagged

Expression Region: 21-147aa

Protein length: Full Length

MW: 17.7 kDa

Alternative Name(s): Prealbumin

Relevance: Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain .

Reference: Isolation and characterization of cDNA for macaque neurological disease genes.Kusuda J., Osada N., Hida M., Sugano S., Hashimoto K. DNA sequences of macaque genes expressed in brain or testis and its evolutionary implications.International consortium for macaque cDNA sequencing and analysis

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share