
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20171228
Research areas: Immunology
Target / Protein: CD3G
Biologically active: Not Tested
Expression system: Yeast
Species of origin: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Delivery time: 3-7 business days
Uniprot ID: Q95LI7
AA Sequence: QSFEENRKLNVYNQEDGSVLLTCHVKNTNITWFKEGKMIDILTAHKNKWNLGSNTKDPRGVYQCKGSKDKSKTLQVYYRMCQNCIELNAAT
Tag info: N-terminal 6xHis-tagged
Expression Region: 23-113aa
Protein length: Extracellular Domain
MW: 12.5 kDa
Alternative Name(s): T-cell receptor T3 gamma chain CD_antigen: CD3g
Relevance: The CD3 complex mediates signal transduction.
Reference: "CD3 polymorphism in cynomolgus monkeys (Macaca fascicularis)."Uda A., Tanabayashi K., Mukai R., Yachi M., Nam K., Yamada A.J. Med. Primatol. 30:141-147(2001) .
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.