Skip to product information
1 of 1

Gene Bio Systems

Recombinant Macaca fascicularis Natural cytotoxicity triggering receptor 3(NCR3)

Recombinant Macaca fascicularis Natural cytotoxicity triggering receptor 3(NCR3)

SKU:CSB-CF015551MOV

Regular price $2,102.80 CAD
Regular price Sale price $2,102.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Uniprot NO.:P61483

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVAPGKEVRNGTPEFRGRLAPLSSSRFLRDHQAELHIWDVRGHDAGIYVCRVEVLGLGVGTGNGTRLVVEKEYPQLGAGTVLLLRAGFYAVSFLSVAVGSTLYYQGKCHCHMGTHCHS

Protein Names:Recommended name: Natural cytotoxicity triggering receptor 3 Alternative name(s): Natural killer cell p30-related protein Short name= NK-p30 Short name= NKp30 CD_antigen= CD337

Gene Names:Name:NCR3

Expression Region:19-176

Sequence Info:full length protein

View full details