Skip to product information
1 of 1

Gene Bio Systems

Recombinant Macaca fascicularis NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13(NDUFA13)

Recombinant Macaca fascicularis NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13(NDUFA13)

SKU:CSB-CF700164MOV

Regular price $2,109.80 CAD
Regular price Sale price $2,109.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Uniprot NO.:Q4R6H1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAVAVCHFRLGPEVWNTASMEMPKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIG TLVYGHWSIMKWNRERRRLQIEDFEARIALMPLFQAETDRRTLQMLRENLEEEAIIMKDV PDWKVGESVFHTTRWVPPLIGELYGLRTTEETIHANYGFMWYT

Protein Names:Recommended name: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 Alternative name(s): Complex I-B16.6 Short name= CI-B16.6 NADH-ubiquinone oxidoreductase B16.6 subunit

Gene Names:Name:NDUFA13 ORF Names:QtsA-18051

Expression Region:1-163

Sequence Info:full length protein

View full details