Skip to product information
1 of 1

Gene Bio Systems

Recombinant Macaca fascicularis Myelin-oligodendrocyte glycoprotein(MOG)

Recombinant Macaca fascicularis Myelin-oligodendrocyte glycoprotein(MOG)

SKU:CSB-CF858994MOV

Regular price $2,191.00 CAD
Regular price Sale price $2,191.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Uniprot NO.:Q9BGS7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:GQFRVIGPRQPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGRDQDGE QAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAIELKVEDPFY WVSPAVLVLLAVLPVLLLQITVGLVFLCLQYRLRGKLRAEIENLHRTFDPHFLRVPCWKI TLFVIVPVLGPLVALIICYNWLHRRLAGQFLEELRNPF

Protein Names:Recommended name: Myelin-oligodendrocyte glycoprotein

Gene Names:Name:MOG ORF Names:QflA-14648

Expression Region:30-247

Sequence Info:full length protein

View full details