Recombinant Macaca fascicularis Lymphotoxin beta receptor (LTBR), partial (Active)

SKU: A0A2K5VGQ6

Size: 100ug. Other sizes are also available.

Activity: Yes

Research Areas: Cell Biology

Uniprot ID: A0A2K5VGQ6

Gene Names: LTBR

Alternative Name(s): /

Abbreviation: Recombinant Cynomolgus monkey LTBR protein, partial (Active)

Organism: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Source: Mammalian cell

Expression Region: 28-229aa

Protein Length: Partial

Tag Info: C-terminal 10xHis-tagged

Target Protein Sequence: SQPQVVRKGPVPPYGSENQTCRDQEKEYYEPRHRICCSRCPPGTYVSAKCSRSRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCEDQGLVEAAPGTAQSDTTCRNPSESLPPEMSGT

MW: 23.6 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/μg as determined by LAL method.

Biological_Activity: Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus LTBR at 2 μg/ml can bind human TNFSF14 (CSB-MP023991HUj7-B), the EC50 is 11.83-14.23 ng/ml.

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: /

Reference: /

Function: