Skip to product information
1 of 1

GeneBio Systems

Recombinant Macaca fascicularis Dipeptidase 3 (DPEP3) (Active)

Recombinant Macaca fascicularis Dipeptidase 3 (DPEP3) (Active)

SKU:Q4R7M2

Regular price $496.40 CAD
Regular price Sale price $496.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Yes

Research Areas: Cancer

Uniprot ID: Q4R7M2

Gene Names: DPEP3

Alternative Name(s):

Abbreviation: Recombinant Cynomolgus monkey DPEP3 protein (Active)

Organism: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Source: Mammalian cell

Expression Region: 36-463aa

Protein Length: Full Length of Mature Protein

Tag Info: C-terminal 10xHis-tagged

Target Protein Sequence: GETTTGAPRALSTLGFPSPFTTPGVPSTLTTPGLTTPGTTKTLDLRSRAQALMRDFPLVDGHNDLPQVLRQRYKNVLQDVNLRNFSHSQTSLDRLRDGLVGAQFWSASVSCQTQDQTAVRLALEQIDLIRRMCASYSELELVTSAEGLNSSQKLACLIGVEGGHSLDSSLSVLRSFYVLGVRYLTLTFTCNTPWAESSTKFTHHMYTNVSGLTSFGEKVVEELNRLGMMIDLSYASDTLMRRVLEVSRAPVIFSHSAARAVCDNSLNVPDDILQLLKKNGGIVMVTLSMGVLQCNLLANVSTVADHFDHIRAVIGSEFIGIGGNYDGAGRFPQGLEDVSTYPVLIEELLSRSWSEKELQGVLRGNLLRVFRQAEKVREESRAQSPMEAEFPYGQLSTSCHSHLVPQNGHQATHLEVTKWPTNRVPWRS

MW: 48.5 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/μg as determined by LAL method.

Biological_Activity: Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis DPEP3 at 2 μg/mL can bind Anti-DPEP3 recombinant antibody (CSB-RA007125MA1HU). The EC50 is 7.817-8.936 ng/mL.

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Lacks dipeptidase activity and is unable to hydrolyze cystinyl-bis-glycine, leukotriene D4 and the beta-lactam antibiotic imipenem. The absence of activity may be due to the inability of asparagine (instead of aspartate found in DPEP1/2) at position 359 to function as the acid/base catalyst and activate the nucleophilic water/hydroxide. A tyrosine (instead of histidine) at position 269 reduces affinity for the beta zinc and may cause substrate steric hindrance.

Reference:

Function:

View full details