Size: 20ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 25-35 working days
Research Topic: Cardiovascular
Uniprot ID: P18659
Gene Names: APOC3
Organism: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
AA Sequence: SEAEDTSLLGFMQGYMQHATKTAKDALTSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKLSGFWDLNPEAKPTLAEAA
Expression Region: 21-99aa
Sequence Info: Full Length of Mature Protein
Source: Baculovirus
Tag Info: N-terminal MBP-tagged and C-terminal 6xHis-tagged
MW: 52.7 kDa
Alternative Name(s): Apolipoprotein C3
Relevance: Component of triglyceride-rich very low density lipoproteins (VLDL) and high density lipoproteins (HDL) in plasma. Plays a multifaceted role in triglyceride homeostasis. Intracellularly, promotes hepatic very low density lipoprotein 1 (VLDL1) assembly and secretion; extracellularly, attenuates hydrolysis and clearance of triglyceride-rich lipoproteins (TRLs). Impairs the lipolysis of TRLs by inhibiting lipoprotein lipase and the hepatic uptake of TRLs by remnant receptors. Formed of several curved helices connected via semiflexible hinges, so that it can wrap tightly around the curved micelle surface and easily adapt to the different diameters of its natural binding partners.
Reference: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.