Gene Bio Systems
Recombinant Lysinibacillus sphaericus UPF0295 protein Bsph_0336 (Bsph_0336)
Recombinant Lysinibacillus sphaericus UPF0295 protein Bsph_0336 (Bsph_0336)
SKU:CSB-CF534138LRV
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Lysinibacillus sphaericus (strain C3-41)
Uniprot NO.:B1HUT5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKPYKSKINKIRSFALALIFIGFIVMYGGIFFKNSPILVLIFMTLGVLCIIGSTVVYAWI GLLSTRAIQVECPNCHKHTKVLGRVDMCMYCNEPLTLDPTLEGKEFDQSYNHKTKKS
Protein Names:Recommended name: UPF0295 protein Bsph_0336
Gene Names:Ordered Locus Names:Bsph_0336
Expression Region:1-117
Sequence Info:full length protein
