Skip to product information
1 of 1

Gene Bio Systems

Recombinant Lysinibacillus sphaericus Probable biotin transporter BioY(bioY)

Recombinant Lysinibacillus sphaericus Probable biotin transporter BioY(bioY)

SKU:CSB-CF326347LRU

Regular price $2,158.80 CAD
Regular price Sale price $2,158.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Lysinibacillus sphaericus (Bacillus sphaericus)

Uniprot NO.:P22819

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLKQQSTLSLVMIAMFAALTAVGAFIKIPLPLVPFTLQIVFVFLAGCLLGGRNGFQSQLV YIGIGLVGLPVFTQGGGITYVLQPTFGYLIGFALAALVIGYMIDRVESPTKKHFIVANII GLIIIYAVAVPYLYVALNVWLNMKSSWSHVFLVGFVNSIVADFCLAIASALLAERLYKVF RSARAIKLVQIEKENV

Protein Names:Recommended name: Probable biotin transporter BioY

Gene Names:Name:bioY

Expression Region:1-196

Sequence Info:full length protein

View full details