Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Others
Uniprot ID: P35840
Gene Names: P39
Organism: Lymantria dispar multicapsid nuclear polyhedrosis virus (LdMNPV)
AA Sequence: MALVSGALSTNRLRNYCVFGAVQPFDNCRAYGSPCSPDSTNNDGWFICDYHSSIRFKIEKMVLPIPDAEGNIYNRTVGKSLVNHKTLGAARVLIPTRDNYKTVLNLNSMSLAEQLVTHMIYDNVEAQGAVCKALQHNENFQTETYRLAEDMFNRTSAILAMTNPRRYCSQVNSNYARIWTTDDVNVAGNVFESMPPFLKNLINVAVAPEQIMIDEKTLVIRNCPTCNIDDSGLVANVQLYNPVVPRYRSTFNENVLHVENVLKFKGNANALQKSLSRYEPYPIVVPLMLGTQTLNTSSAYKQFTVPTRDDFAALNQRTGAAAAAPPAPAAAPAGPRPAAELEYDETLDRFARWRAR
Expression Region: 1-356aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW: 44.6 kDa
Alternative Name(s):
Relevance: Expressed late in infection.
Reference: "Nucleotide sequence of the p39-capsid gene region of the Lymantria dispar nuclear polyhedrosis virus." Bjoernson R.M., Rohrmann G.F. J. Gen. Virol. 73:1505-1508(1992)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.