Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) (Yeast) (Saccharomyces elongisporus)
Uniprot NO.:A5E7J0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTPALYRVRQPFFWRNTISLFVIGSIPLAAYWYTFTKMTEDEFSDIPIPPISDEELTKLK KEYEAGKQ
Protein Names:Recommended name: Cytochrome oxidase assembly protein 3, mitochondrial
Gene Names:Name:COA3 ORF Names:LELG_05579
Expression Region:1-68
Sequence Info:full length protein