Skip to product information
1 of 1

Gene Bio Systems

Recombinant Locusta migratoria ATP synthase subunit a(ATP6)

Recombinant Locusta migratoria ATP synthase subunit a(ATP6)

SKU:CSB-CF015070LHY

Regular price $2,200.80 CAD
Regular price Sale price $2,200.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Locusta migratoria (Migratory locust)

Uniprot NO.:P14569

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MMTNLFSTFDPSTNLFNLSLNWTSTFLGLLLIPSMFWLMPSRINILWNKMNLNLHNEFKT LLGKNSFQGSTLILISIFIMMLFNNFMGLFPYIFTSTSHMTLTFSIALPMWMSFMLFGWI NNTNHMFTHLVPQGTPNALMSFMVLIETISNVIRPGTLAVRLAANMIAGHLLLTLLGNTG PSLTTSIMLFLIIGQMLLLILESAVAMIQAYVFSILSTLYSSEVY

Protein Names:Recommended name: ATP synthase subunit a Alternative name(s): F-ATPase protein 6

Gene Names:Name:ATP6

Expression Region:1-225

Sequence Info:full length protein

View full details