Skip to product information
1 of 1

Gene Bio Systems

Recombinant Listeria welshimeri serovar 6b Putative AgrB-like protein (lwe0039)

Recombinant Listeria welshimeri serovar 6b Putative AgrB-like protein (lwe0039)

SKU:CSB-CF366353LLT

Regular price $2,170.00 CAD
Regular price Sale price $2,170.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334)

Uniprot NO.:A0AEM5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSNFTVKVPLSERMADVLISKDRWKDDEEGYLKVKYGLEIILINVMKFAIVYGISLATGL LLQTVTVHMSYLWLRRYSFGLHATKTLNCTLISLAMFVLAPFVFQNIPSNNWIVLGTFAF ILLNMFLFAPADTESLPLIGEKHRKTLKRKAMIGTLILTGIALLIPFAEMKTLIMVGSLF QVISINPLSYKLLKRRYRNYEKYE

Protein Names:Recommended name: Putative AgrB-like protein EC= 3.4.-.-

Gene Names:Ordered Locus Names:lwe0039

Expression Region:1-204

Sequence Info:full length protein

View full details