Skip to product information
1 of 1

Gene Bio Systems

Recombinant Listeria monocytogenes serovar 1-2a UPF0316 protein lmo1776(lmo1776)

Recombinant Listeria monocytogenes serovar 1-2a UPF0316 protein lmo1776(lmo1776)

SKU:CSB-CF835022LPY

Regular price $2,126.60 CAD
Regular price Sale price $2,126.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)

Uniprot NO.:Q8Y6B5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDNGIFIVVTIFIVNILYVTIYTVRLLLTMKGYRYLAALSSVFEMIIYVVALSLVLDNLN NIANVLAYAVGFGVGIIVGMKIEERIALGYITVNVITKEYNLDLPNQIRDLGYGVTSWLA SGRDGERMMLEILTQRKNERKLYKHIIEIDNGAFIVSSEPKQIHGGFWVKQVRK

Protein Names:Recommended name: UPF0316 protein lmo1776

Gene Names:Ordered Locus Names:lmo1776

Expression Region:1-174

Sequence Info:full length protein

View full details