Gene Bio Systems
Recombinant Listeria monocytogenes serovar 1-2a UPF0266 membrane protein lmo0779(lmo0779)
Recombinant Listeria monocytogenes serovar 1-2a UPF0266 membrane protein lmo0779(lmo0779)
SKU:CSB-CF835045LPY
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Uniprot NO.:Q8Y8W3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MVWDATNIFLFAANILTVLYILYNDAVIPLWKGKTVLSVKLRSRGRWDGYIFVGIIVLLF VSNTFFREGPFSTSVLLGIMGVLFIYICFFRSSKAVFKESGLFYALLFFPYAKIERMNLS EDGVLVIETNRQRLMLFARSEKDLEKMLAVFTTYS
Protein Names:Recommended name: UPF0266 membrane protein lmo0779
Gene Names:Ordered Locus Names:lmo0779
Expression Region:1-155
Sequence Info:full length protein
