Gene Bio Systems
Recombinant Listeria monocytogenes serovar 1-2a UPF0154 protein lmo1306 (lmo1306)
Recombinant Listeria monocytogenes serovar 1-2a UPF0154 protein lmo1306 (lmo1306)
SKU:CSB-CF300014LPY
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Uniprot NO.:P67288
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MWIYILVGIICLLAGLAGGFFIARRYMMSYLKNNPPINEQMLQMMMAQMGQKPSQKKINQMMSAMNKQQEKEKPKKAKK
Protein Names:Recommended name: UPF0154 protein lmo1306
Gene Names:Ordered Locus Names:lmo1306
Expression Region:1-79
Sequence Info:full length protein
