Skip to product information
1 of 1

Gene Bio Systems

Recombinant Listeria monocytogenes serovar 1-2a UPF0154 protein lmo1306 (lmo1306)

Recombinant Listeria monocytogenes serovar 1-2a UPF0154 protein lmo1306 (lmo1306)

SKU:CSB-CF300014LPY

Regular price $1,985.20 CAD
Regular price Sale price $1,985.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)

Uniprot NO.:P67288

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MWIYILVGIICLLAGLAGGFFIARRYMMSYLKNNPPINEQMLQMMMAQMGQKPSQKKINQMMSAMNKQQEKEKPKKAKK

Protein Names:Recommended name: UPF0154 protein lmo1306

Gene Names:Ordered Locus Names:lmo1306

Expression Region:1-79

Sequence Info:full length protein

View full details