Recombinant Listeria innocua serovar 6a UPF0154 protein lin1344 (lin1344)

SKU: CSB-CF300642LGU

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Listeria innocua serovar 6a (strain CLIP 11262)

Uniprot NO.:P67289

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MWIYILVGIICLLAGLAGGFFIARRYMMSYLKNNPPINEQMLQMMMAQMGQKPSQKKINQMMSAMNKQQEKEKPKKAKK

Protein Names:Recommended name: UPF0154 protein lin1344

Gene Names:Ordered Locus Names:lin1344

Expression Region:1-79

Sequence Info:full length protein