Skip to product information
1 of 1

Gene Bio Systems

Recombinant Listeria innocua serovar 6a Membrane protein insertase YidC 2(yidC2)

Recombinant Listeria innocua serovar 6a Membrane protein insertase YidC 2(yidC2)

SKU:CSB-CF856418LGU

Regular price $2,254.00 CAD
Regular price Sale price $2,254.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Listeria innocua serovar 6a (strain CLIP 11262)

Uniprot NO.:Q926Q5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:CGYSTDPITKDSTGFWSHYIVFPLSWVITWFSDLFGGNYAVGIIVVTILIRLLIMPLMIK QLKSQKAMTSLQPKIKELQEKYSSKDNETKQKLQQETMRLYQENSVNPMMGCLPLLIQMP ILLGFYQAISRTAEIKTDTFLWMQLGNPDPYYILPIVAALTTFLSSKISMMGQTQQNKSM AMIVYIMPVMILFMGITLPSALALYWIIGNIFTVFQTLLINNPFKNKREQEALAAAQLEE ERLKKKAANMKASKKGGKKRK

Protein Names:Recommended name: Membrane protein insertase YidC 2 Alternative name(s): Foldase YidC 2 Membrane integrase YidC 2 Membrane protein YidC 2

Gene Names:Name:yidC2 Ordered Locus Names:lin2986

Expression Region:27-287

Sequence Info:full length protein

View full details