Skip to product information
1 of 1

Gene Bio Systems

Recombinant Liriodendron tulipifera Photosystem II reaction center protein H(psbH)

Recombinant Liriodendron tulipifera Photosystem II reaction center protein H(psbH)

SKU:CSB-CF603561LGR

Regular price $1,763.75 CAD
Regular price Sale price $1,763.75 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Liriodendron tulipifera (Tuliptree) (Tulip poplar)

Uniprot NO.:Q0G9J0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ATQTVEGSSRSGPRRTITGDLLKPLNSEYGKVAPGWGTTPFMGVAMALFAIFLSIILEIY NSSVLLDGISMS

Protein Names:Recommended name: Photosystem II reaction center protein H Short name= PSII-H Alternative name(s): Photosystem II 10 kDa phosphoprotein

Gene Names:Name:psbH

Expression Region:2-73

Sequence Info:full length protein

View full details