Skip to product information
1 of 1

Gene Bio Systems

Recombinant Leuconostoc citreum UPF0397 protein LCK_00164 (LCK_00164)

Recombinant Leuconostoc citreum UPF0397 protein LCK_00164 (LCK_00164)

SKU:CSB-CF540825LPD

Regular price $2,146.20 CAD
Regular price Sale price $2,146.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Leuconostoc citreum (strain KM20)

Uniprot NO.:B1MWU5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MHNQKKNQGFSVKSVVATGIGAAVFFVLMKFIAIPTGVPNTTINVAEGWLALIAGLFGPV VGLLVGLIGHTLNDAVTYGAPWWSWVIADGVFGLLLGFGKKYLALEYGELTTKKLVQFNV WQAVSNVLVWVIIAPLGDIIIYKEAAQKVFLQGAVTTVVNTISVAIIGSLLLVAYVKSRP KKSSLRSE

Protein Names:Recommended name: UPF0397 protein LCK_00164

Gene Names:Ordered Locus Names:LCK_00164

Expression Region:1-188

Sequence Info:full length protein

View full details