Skip to product information
1 of 1

Gene Bio Systems

Recombinant Leptospira borgpetersenii serovar Hardjo-bovis UPF0316 protein LBL_2483 (LBL_2483)

Recombinant Leptospira borgpetersenii serovar Hardjo-bovis UPF0316 protein LBL_2483 (LBL_2483)

SKU:CSB-CF312181LET

Regular price $2,158.80 CAD
Regular price Sale price $2,158.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)

Uniprot NO.:Q04YI7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MELNPGNPIFDYCVLPCFIFLARVTDVSIGTIRVILLTREKKVIAASLGFLEVLLWVIVI TQVIKNLNNALCYLAYAGGFAAGTFIGMILEEKLAIGFSLLRIISPRNGDEIANKLSEAG YGVTTMNGQGSRGPVKIVFTVLKRKKIGQAMTIVKSVEPDVFYSIENARSTNTAVSEDSP GLLRIGILEKILKVRK

Protein Names:Recommended name: UPF0316 protein LBL_2483

Gene Names:Ordered Locus Names:LBL_2483

Expression Region:1-196

Sequence Info:full length protein

View full details