Recombinant Legionella pneumophila Outer membrane protein MIP(mip)

Recombinant Legionella pneumophila Outer membrane protein MIP(mip)

CSB-YP401660LLJ
Regular price
$1,169.57 CAD
Sale price
$1,169.57 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Immunology

Uniprot ID: A5IGB8

Gene Names: mip

Organism: Legionella pneumophila (strain Corby)

AA Sequence: ATDATSLATDKDKLSYSIGADLGKNFKNQGIDVNPEAMAKGMQDAMSGAQLALTEQQMKDVLNKFQKDLMAKRTAEFNKKADENKVKGEAFLTENKNKPGVVVLPSGLQYKVINAGNGVKPGKSDTVTVEYTGRLIDGTVFDSTEKTGKPATFQVSQVIPGWTEALQLMPAGSTWEIYVPSGLAYGPRSVGGPIGPNETLIFKIHLISVKKSS

Expression Region: 21-233aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 24.8 kDa

Alternative Name(s): Macrophage infectivity potentiator Peptidyl-prolyl cis-trans isomerase Short name: PPIase

Relevance: Essential virulence factor associated with macrophage infectivity. Exhibits PPIase activity.

Reference: "Characterization of Mip proteins of Legionella pneumophila."Ludwig B., Rahfeld J., Schmidt B., Mann K., Wintermeyer E., Fischer G., Hacker J.FEMS Microbiol. Lett. 118:23-30(1994)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share