Skip to product information
1 of 1

Gene Bio Systems

Recombinant Lactuca sativa Photosystem I assembly protein Ycf4(ycf4)

Recombinant Lactuca sativa Photosystem I assembly protein Ycf4(ycf4)

SKU:CSB-CF654236LNJ

Regular price $2,140.60 CAD
Regular price Sale price $2,140.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Lactuca sativa (Garden lettuce)

Uniprot NO.:Q332W7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSCRSEHIWIEPITGARKTSNFCWAVILFLGSLGFLLVGTSSYLGRNLISLFPSQEIVFF PQGIVMSFYGIAGLFISSYLWCTISWNVGSGYDRFDRKDGIVCIFRWGFPGKNRRVFLQF LIKDIQSVRIEVKEGIYARRVLYMDIRGQGAIPLTRTDENFTPREMEQKAAELAYFLRVP IEVF

Protein Names:Recommended name: Photosystem I assembly protein Ycf4

Gene Names:Name:ycf4

Expression Region:1-184

Sequence Info:full length protein

View full details