Skip to product information
1 of 1

Gene Bio Systems

Recombinant Lactococcus lactis subsp. cremoris Thiamine transporter ThiT(thiT)

Recombinant Lactococcus lactis subsp. cremoris Thiamine transporter ThiT(thiT)

SKU:CSB-CF382286LND

Regular price $2,137.80 CAD
Regular price Sale price $2,137.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Lactococcus lactis subsp. cremoris (strain MG1363)

Uniprot NO.:A2RI47

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSNSKFNVRLLTEIAFMAALAFIISLIPNTVYGWIIVEIACIPILLLSLRRGLTAGLVGG LIWGILSMITGHAYILSLSQAFLEYLVAPVSLGIAGLFRQKTAPLKLAPVLLGTFVAVLL KYFFHFIAGIIFWSQYAWKGWGAVAYSLAVNGISGILTAIAAFVILIIFVKKFPKLFIHS NY

Protein Names:Recommended name: Thiamine transporter ThiT Alternative name(s): Thiamine ECF transporter S component ThiT

Gene Names:Name:thiT Ordered Locus Names:llmg_0334

Expression Region:1-182

Sequence Info:full length protein

View full details