Gene Bio Systems
Recombinant Lactococcus lactis subsp. cremoris Thiamine precursor transporter HmpT(hmpT)
Recombinant Lactococcus lactis subsp. cremoris Thiamine precursor transporter HmpT(hmpT)
SKU:CSB-CF382291LND
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Lactococcus lactis subsp. cremoris (strain MG1363)
Uniprot NO.:A2RIH3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKLMDNKNIKKLTLLAIWTALTFVLGRLFTFPIPGSAGNILTLLDVGIYTAVFLFGKREA AIIGGFAAFLLDLTAGFSNYMFFSLIIHGGQGYLAGLTRYKWLNFLLSLLVMVGGYFIVG GLMYGWGSAIAGLWVNIVQVIVGFVLAKVLSPLIERTGILNGFRKA
Protein Names:Recommended name: Thiamine precursor transporter HmpT Alternative name(s): Thiamine precursor ECF transporter S component HmpT
Gene Names:Name:hmpT Ordered Locus Names:llmg_0464
Expression Region:1-166
Sequence Info:full length protein
