Gene Bio Systems
Recombinant Lactococcus lactis subsp. cremoris Multi-drug resistance efflux pump pmrA homolog(pmrA)
Recombinant Lactococcus lactis subsp. cremoris Multi-drug resistance efflux pump pmrA homolog(pmrA)
SKU:CSB-CF335264LNF
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Lactococcus lactis subsp. cremoris (Streptococcus cremoris)
Uniprot NO.:P27173
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:ILIGLVFTFVIYLPMAFVQSPLQLGILRFLLGFGAGALMPSVNSLLSKITPKEGVSRIFA YAQMCSNLGMVTGPLVGSAIAGYISYRAAIVGTSLFVIVNIIWSFINFRKYLRKRSIME
Protein Names:Recommended name: Multi-drug resistance efflux pump pmrA homolog
Gene Names:Name:pmrA
Expression Region:1-119
Sequence Info:full length protein
