Skip to product information
1 of 1

Gene Bio Systems

Recombinant Lactococcus lactis subsp. cremoris Lipid II flippase FtsW(ftsW)

Recombinant Lactococcus lactis subsp. cremoris Lipid II flippase FtsW(ftsW)

SKU:CSB-CF340851LNF

Regular price $2,161.60 CAD
Regular price Sale price $2,161.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Lactococcus lactis subsp. cremoris (Streptococcus cremoris)

Uniprot NO.:P27174

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNLNKNNFLNYSILIPYLILAGIGIVMIFSTTVPDQLQKGLNPYKLVINQTAFVLLSIIM IAVIYRLKLRALKNRKMIGIIMVILILSLIFCRIMPSSFALTAPVNGARGWIHIPGIGTV QPAEFAKVFIIWYLASVFSTKQEEIEKNDINEIFKGKTLTQKLFGGWRLPVVAILLVDLI MPDLGNTMIIGAVALIMI

Protein Names:Recommended name: Lipid II flippase FtsW Alternative name(s): Cell division protein FtsW

Gene Names:Name:ftsW

Expression Region:1-198

Sequence Info:full length protein

View full details