Gene Bio Systems
Recombinant Lactobacillus sakei subsp. sakei UPF0756 membrane protein LSA1031(LSA1031)
Recombinant Lactobacillus sakei subsp. sakei UPF0756 membrane protein LSA1031(LSA1031)
SKU:CSB-CF656473LAAF
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Lactobacillus sakei subsp. sakei (strain 23K)
Uniprot NO.:Q38WU8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MESWLFLAAILIVALLAKNQSLIIATAVVLVLKALPISEKVLPVIQAKGINWGVTVISVA ILVPIATGQIGFKELISAFKTPAGFIAVGCGVLVAVLSAKGVGLLAASPEMTVALVFGTI MGVVFLKGIAAGPVIAAGITYTILTIFNLVPIH
Protein Names:Recommended name: UPF0756 membrane protein LSA1031
Gene Names:Ordered Locus Names:LSA1031
Expression Region:1-153
Sequence Info:full length protein
