Recombinant Lactobacillus sakei subsp. sakei  Large-conductance mechanosensitive channel(mscL)

Recombinant Lactobacillus sakei subsp. sakei Large-conductance mechanosensitive channel(mscL)

CSB-CF655061LAAF
Regular price
$1,474.00 CAD
Sale price
$1,474.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Lactobacillus sakei subsp. sakei (strain 23K)

Uniprot NO.:Q38V39

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIKEFKEFIMRGNVLDMAVGVILGAALKSIVDSLTKNLINPIISLFVGQVDLSGIAVTIP GTKAVFQIGNFLNDVINFLIIAIIVFLIVKGFNKLRDMGKKTEEEVAEEAAPTQEELYLK EIRDLLANKDHQ

Protein Names:Recommended name: Large-conductance mechanosensitive channel

Gene Names:Name:mscL Ordered Locus Names:LCA_1638

Expression Region:1-132

Sequence Info:full length protein

Your list is ready to share