Skip to product information
1 of 1

Gene Bio Systems

Recombinant Lactobacillus reuteri Cobalt transport protein CbiM(cbiM)

Recombinant Lactobacillus reuteri Cobalt transport protein CbiM(cbiM)

SKU:CSB-CF403928LLF

Regular price $2,189.60 CAD
Regular price Sale price $2,189.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Lactobacillus reuteri (strain DSM 20016)

Uniprot NO.:A5VM74

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MHIMEGMLPPRWCIFWYAVSLPFFIYGLYRMYKIVNSGVPNAKVMLALCGAFVFVLSSLK LPSVTGSCSHPTGVGLGTVLFGPGVMSVLGVIVLLFQALLLAHGGITTLGANEFSMTIVG PIVGYAVWKLCRAMKVSRSVSLFLCAMFADWSTYVTTAFQLAIVFPDPNGGVAAALIKFL SIYAITQIPLAIAEGLLTVIVYNLVISNDLWKESALQ

Protein Names:Recommended name: Cobalt transport protein CbiM Alternative name(s): Energy-coupling factor transporter probable substrate-capture protein CbiM Short name= ECF transporter S component CbiM

Gene Names:Name:cbiM Ordered Locus Names:Lreu_1709

Expression Region:32-248

Sequence Info:full length protein

View full details